Loading...
Catalog No: ARP39622_P050
Price: $0.00
SKU
ARP39622_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CBLL1 (ARP39622_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CBLL1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR
Concentration0.5 mg/ml
Blocking PeptideFor anti-CBLL1 (ARP39622_P050) antibody is Catalog # AAP39622 (Previous Catalog # AAPP21642)
ReferenceOta,T., J. Cell. Sci. 117 (PT 7), 989-998 (2004)
Publications

Zc3h13/Flacc is required for adenosine methylation by bridging the mRNA-binding factor Rbm15/Spenito to the m6A machinery component Wtap/Fl(2)d. Genes Dev. 32, 415-429 (2018). 29535189

Description
Gene SymbolCBLL1
Gene Full NameCbl proto-oncogene, E3 ubiquitin protein ligase-like 1
Alias SymbolsHAKAI, RNF188
NCBI Gene Id79872
Protein NameE3 ubiquitin-protein ligase Hakai
Description of TargetEpithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a conse
Uniprot IDQ75N03
Protein Accession #NP_079090
Nucleotide Accession #NM_024814
Protein Size (# AA)491
Molecular Weight54kDa
Protein InteractionsDGCR6; SUMO1; UBC; CDH1; RNF2; YWHAQ; SFPQ; Cbll1; ESR1; CTTN; DOK1; SRC; CDC42;
  1. What is the species homology for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig, Rabbit".

  2. How long will it take to receive "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBLL1 Antibody - N-terminal region (ARP39622_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    This target may also be called "HAKAI, RNF188" in publications.

  5. What is the shipping cost for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBLL1 Antibody - N-terminal region (ARP39622_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CBLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBLL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBLL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBLL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBLL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBLL1 Antibody - N-terminal region (ARP39622_P050)
Your Rating
We found other products you might like!