Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP39623_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP39623_T100-FITC Conjugated

ARP39623_T100-HRP Conjugated

ARP39623_T100-Biotin Conjugated

CBLL1 Antibody - C-terminal region (ARP39623_T100)

Catalog#: ARP39623_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101912 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CBLL1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-CBLL1 (ARP39623_T100)
Peptide SequenceSynthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CBLL1 (ARP39623_T100) antibody is Catalog # AAP39623 (Previous Catalog # AAPP21643)
Datasheets/ManualsPrintable datasheet for anti-CBLL1 (ARP39623_T100) antibody
Target ReferenceStrausberg,R.L., (2004) J. Cell. Sci. 117 (PT 7), 989-998
Publications

Horiuchi, K. et al. Identification of Wilms’ Tumor 1-associating Protein Complex and Its Role in Alternative Splicing and the Cell Cycle. J. Biol. Chem. 288, 33292-302 (2013). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish 24100041

Gene SymbolCBLL1
Official Gene Full NameCbl proto-oncogene, E3 ubiquitin protein ligase-like 1
Alias SymbolsHAKAI, RNF188
NCBI Gene Id79872
Protein NameE3 ubiquitin-protein ligase Hakai
Description of TargetEpithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM].
Swissprot IdQ75N03
Protein Accession #NP_079090
Nucleotide Accession #NM_024814
Protein Size (# AA)491
Molecular Weight55kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CBLL1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CBLL1.
Protein InteractionsDGCR6; SUMO1; UBC; CDH1; RNF2; YWHAQ; SFPQ; Cbll1; ESR1; CTTN; DOK1; SRC; CDC42;
  1. What is the species homology for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish".

  2. How long will it take to receive "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBLL1 Antibody - C-terminal region (ARP39623_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    This target may also be called "HAKAI, RNF188" in publications.

  5. What is the shipping cost for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBLL1 Antibody - C-terminal region (ARP39623_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "CBLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBLL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBLL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBLL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBLL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBLL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBLL1 Antibody - C-terminal region (ARP39623_T100)
Your Rating
Aviva Blast Tool
Aviva Live Chat
Assay Development
Aviva Validation Data