Search Antibody, Protein, and ELISA Kit Solutions

CBLL1 Antibody - C-terminal region (ARP39623_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39623_T100-FITC Conjugated

ARP39623_T100-HRP Conjugated

ARP39623_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1
NCBI Gene Id:
Protein Name:
E3 ubiquitin-protein ligase Hakai
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101912 from Santa Cruz Biotechnology.
Description of Target:
Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBLL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBLL1.
The immunogen is a synthetic peptide directed towards the C terminal region of human CBLL1
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-CBLL1 (ARP39623_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CBLL1 (ARP39623_T100) antibody is Catalog # AAP39623 (Previous Catalog # AAPP21643)
Printable datasheet for anti-CBLL1 (ARP39623_T100) antibody
Target Reference:
Strausberg,R.L., (2004) J. Cell. Sci. 117 (PT 7), 989-998

Horiuchi, K. et al. Identification of Wilms’ Tumor 1-associating Protein Complex and Its Role in Alternative Splicing and the Cell Cycle. J. Biol. Chem. 288, 33292-302 (2013). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish 24100041

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...