Search Antibody, Protein, and ELISA Kit Solutions

Cbll1 Antibody - C-terminal region (ARP33600_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33600_P050-FITC Conjugated

ARP33600_P050-HRP Conjugated

ARP33600_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Casitas B-lineage lymphoma-like 1
NCBI Gene Id:
Protein Name:
E3 ubiquitin-protein ligase Hakai
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AI467391, Hakai, c-Cbl-like
Replacement Item:
This antibody may replace item sc-101912 from Santa Cruz Biotechnology.
Description of Target:
Cbll1 promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cbll1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cbll1.
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-Cbll1 (ARP33600_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-Cbll1 (ARP33600_P050) antibody is Catalog # AAP33600 (Previous Catalog # AAPP04656)
Printable datasheet for anti-Cbll1 (ARP33600_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...