CBLL1 Antibody - N-terminal region (ARP39622_P050)

Data Sheet
 
Product Number ARP39622_P050
Product Page www.avivasysbio.com/cbll1-antibody-n-terminal-region-arp39622-p050.html
Name CBLL1 Antibody - N-terminal region (ARP39622_P050)
Protein Size (# AA) 491 amino acids
Molecular Weight 54kDa
NCBI Gene Id 79872
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1
Description
Alias Symbols HAKAI, RNF188
Peptide Sequence Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., J. Cell. Sci. 117 (PT 7), 989-998 (2004)
Description of Target Epithelial cell cadherin is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. CBLL1 is an E3 ubiquitin ligase that mediates ubiquitination of the CDH1 complex.Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a conse
Protein Interactions DGCR6; SUMO1; UBC; CDH1; RNF2; YWHAQ; SFPQ; Cbll1; ESR1; CTTN; DOK1; SRC; CDC42;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CBLL1 (ARP39622_P050) antibody
Blocking Peptide For anti-CBLL1 (ARP39622_P050) antibody is Catalog # AAP39622 (Previous Catalog # AAPP21642)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CBLL1
Uniprot ID Q75N03
Protein Name E3 ubiquitin-protein ligase Hakai
Publications

Zc3h13/Flacc is required for adenosine methylation by bridging the mRNA-binding factor Rbm15/Spenito to the m6A machinery component Wtap/Fl(2)d. Genes Dev. 32, 415-429 (2018). 29535189

Protein Accession # NP_079090
Purification Affinity Purified
Nucleotide Accession # NM_024814
Tested Species Reactivity Human
Gene Symbol CBLL1
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Image 1
Human COLO205
WB Suggested Anti-CBLL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: COLO205 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com