Search Antibody, Protein, and ELISA Kit Solutions

Cbfa2t2 Antibody - middle region (ARP37524_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37524_P050-FITC Conjugated

ARP37524_P050-HRP Conjugated

ARP37524_P050-Biotin Conjugated

Gene Symbol:
Cbfa2t2
Official Gene Full Name:
Core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
NCBI Gene Id:
12396
Protein Name:
Protein CBFA2T2
Swissprot Id:
O70374
Protein Accession #:
NP_766448
Nucleotide Accession #:
NM_172860
Alias Symbols:
A430091M07, C330013D05Rik, Cbfa2t2h, MTGR1
Replacement Item:
This antibody may replace item sc-390114 from Santa Cruz Biotechnology.
Description of Target:
Cbfa2t2 may be a transcriptional corepressor.
Protein Size (# AA):
594
Molecular Weight:
66kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Cbfa2t2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Cbfa2t2.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-Cbfa2t2 (ARP37524_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Cbfa2t2 (ARP37524_P050) antibody is Catalog # AAPP09630
Datasheets/Manuals:
Printable datasheet for anti-Cbfa2t2 (ARP37524_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...