| Product Number |
ARP37524_P050 |
| Product Page |
www.avivasysbio.com/cbfa2t2-antibody-middle-region-arp37524-p050.html |
| Name |
Cbfa2t2 Antibody - middle region (ARP37524_P050) |
| Protein Size (# AA) |
594 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
12396 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human) |
| Alias Symbols |
MTGR, MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Cbfa2t2 may be a transcriptional corepressor. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Cbfa2t2 (ARP37524_P050) antibody |
| Blocking Peptide |
For anti-Cbfa2t2 (ARP37524_P050) antibody is Catalog # AAPP09630 |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
O70374 |
| Protein Name |
Protein CBFA2T2 |
| Protein Accession # |
NP_766448 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172860 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Cbfa2t2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-Cbfa2t2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Brain |
|
|
