SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP38558_P050
Price: $0.00
SKU
ARP38558_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CBFA2T2 (ARP38558_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: AKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPL
Concentration0.5 mg/ml
Blocking PeptideFor anti-CBFA2T2 (ARP38558_P050) antibody is Catalog # AAP38558 (Previous Catalog # AAPP20748)
Sample Type Confirmation

CBFA2T2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

ReferenceKumar,R., (2006) Mol. Cancer Res. 4 (9), 655-665
Gene SymbolCBFA2T2
Gene Full NameCore-binding factor, runt domain, alpha subunit 2; translocated to, 2
Alias SymbolsEHT, p85, MTGR1, ZMYND3
NCBI Gene Id9139
Protein NameProtein CBFA2T2
Description of TargetIn acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. CBFA2T2 binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 (AML1) gene fused to the 3'-region of the CBFA2T1 (MTG8) gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. The protein encoded by this gene binds to the AML1-MTG8 complex and may be important in promoting leukemogenesis. Several transcript variants are thought to exist for this gene, but the full-length natures of only three have been described.
Uniprot IDO43439
Protein Accession #NP_005084
Nucleotide Accession #NM_005093
Protein Size (# AA)604
Molecular Weight67kDa
Protein InteractionsPRDM14; PDP1; CBFA2T2; TCP1; MDFI; RUNX1T1; LBP; APP; ATXN1L; ATN1; RERE; RUNX1; SIN3A; NCOR1; HDAC3; FBXL19; TAL2; NEUROG1; ID3; GTF2E1; WDYHV1; CBFA2T3; NCOR2; CBFB; TAL1;
  1. What is the species homology for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    This target may also be called "EHT, p85, MTGR1, ZMYND3" in publications.

  5. What is the shipping cost for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CBFA2T2 Antibody - N-terminal region (ARP38558_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CBFA2T2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CBFA2T2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CBFA2T2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CBFA2T2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CBFA2T2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CBFA2T2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CBFA2T2 Antibody - N-terminal region (ARP38558_P050)
Your Rating
We found other products you might like!