Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

CBFA2T2H Antibody - middle region (ARP37525_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37525_P050-FITC Conjugated

ARP37525_P050-HRP Conjugated

ARP37525_P050-Biotin Conjugated

Gene Symbol:
Cbfa2t2
Official Gene Full Name:
Core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
NCBI Gene Id:
12396
Protein Name:
Protein CBFA2T2
Swissprot Id:
Q6P288
Protein Accession #:
NP_766448
Nucleotide Accession #:
NM_172860
Alias Symbols:
MTGR1, Cbfa2t2h, A430091M07, C330013D05Rik
Replacement Item:
This antibody may replace item sc-390114 from Santa Cruz Biotechnology.
Description of Target:
Mouse Cbfa2t2h associates with mSin3A, N-CoR, and histone deacetylase 3 and that when tethered to DNA, it acts as a transcriptional corepressor.
Protein Size (# AA):
594
Molecular Weight:
65kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBFA2T2H.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBFA2T2H.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse CBFA2T2H
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-CBFA2T2H (ARP37525_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRSMAVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Cbfa2t2 (ARP37525_P050) antibody is Catalog # AAP37525 (Previous Catalog # AAPP09631)
Datasheets/Manuals:
Printable datasheet for anti-Cbfa2t2 (ARP37525_P050) antibody
Target Reference:
Yoshikawa,T., et al., (er) Gene Expr. Patterns (2005) In press

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...