ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: AVARP09021_P050
Price: $0.00
SKU
AVARP09021_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CAV3 (AVARP09021_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CAV3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 84%; Pig: 92%; Rat: 84%
Peptide SequenceSynthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CAV3 (AVARP09021_P050) antibody is Catalog # AAP30146 (Previous Catalog # AAPP00303)
ReferenceAlias,L., et al., (2004) Neuromuscul. Disord. 14 (5), 321-324
Gene SymbolCAV3
Gene Full NameCaveolin 3
Alias SymbolsLQT9, MPDT, RMD2, VIP21, LGMD1C, VIP-21
NCBI Gene Id859
Protein NameCaveolin-3
Description of TargetCAV3 is a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
Uniprot IDP56539
Protein Accession #NP_001225
Nucleotide Accession #NM_001234
Protein Size (# AA)151
Molecular Weight17kDa
Protein InteractionsKCNMA1; PTGES3; SCN5A; PCBP1; NEDD4L; KCNH2; SUMO2; SUMO3; ADRB2; JPH2; SLC22A11; DYSF; PFKM; SLC8A1; NOS1; INSR; GNAS; EGFR; DAG1; PDGFRB; PDGFRA;
  1. What is the species homology for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Pig".

  2. How long will it take to receive "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CAV3 Antibody - N-terminal region (AVARP09021_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    This target may also be called "LQT9, MPDT, RMD2, VIP21, LGMD1C, VIP-21" in publications.

  5. What is the shipping cost for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CAV3 Antibody - N-terminal region (AVARP09021_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CAV3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CAV3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CAV3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CAV3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CAV3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CAV3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CAV3 Antibody - N-terminal region (AVARP09021_P050)
Your Rating
We found other products you might like!