CAV3 Antibody (OAAL00040)

Catalog No: OAAL00040

Size:100 ug

Detection limit for recombinant GST tagged CAV3 is 0.3 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1B9
• Isotype: IgG2b Kappa
• Host: Mouse
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: CAV3 (NP_001225, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVP
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: CAV3
• Gene Full Name: caveolin 3
• Alias Symbols: ATP5A, ATP5G2
• NCBI Gene Id: 517
• Description of Target: This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq
• Protein Accession #: NP_001225