- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for C1D Antibody (OAAL00520) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid |
| Clonality | Monoclonal |
| Clone | 4H5 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | C1D (AAH16284, 1 a.a. ~ 141 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | C1D |
|---|---|
| Gene Full Name | C1D nuclear receptor corepressor |
| Alias Symbols | C1D DNA-binding protein;C1D nuclear receptor co-repressor;hC1D;LRP1;nuclear DNA-binding protein;nuclear nucleic acid-binding protein C1D;Rrp47;small unique nuclear receptor corepressor;small unique nuclear receptor co-repressor;SUN-CoR;SUNCOR. |
| NCBI Gene Id | 10438 |
| Protein Name | C1D nuclear receptor co-repressor [Homo sapiens]|Homo sapiens C1D nuclear receptor co-repressor, mRNA (cDNA clone MGC:9308 IMAGE:3906517), complete cds |
| Description of Target | The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Several alternatively spliced transcript variants of this gene have been described, but the full length nature of some of these variants has not been determined. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH16284 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC016284 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "C1D Antibody (OAAL00520)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "C1D Antibody (OAAL00520)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "C1D Antibody (OAAL00520)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "C1D Antibody (OAAL00520)"?
This target may also be called "C1D DNA-binding protein;C1D nuclear receptor co-repressor;hC1D;LRP1;nuclear DNA-binding protein;nuclear nucleic acid-binding protein C1D;Rrp47;small unique nuclear receptor corepressor;small unique nuclear receptor co-repressor;SUN-CoR;SUNCOR." in publications.
-
What is the shipping cost for "C1D Antibody (OAAL00520)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "C1D Antibody (OAAL00520)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "C1D Antibody (OAAL00520)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "C1D Antibody (OAAL00520)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "C1D"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "C1D"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "C1D"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "C1D"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "C1D"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "C1D"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
