BOLL Antibody (OAAL00801)

Catalog No: OAAL00801

Size:100UG

BOLL monoclonal antibody (M14), clone 1G3. Western Blot analysis of BOLL expression in Y-79.

Immunofluorescence of monoclonal antibody to BOLL on HeLa cell. [antibody concentration 20 ug/ml]

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1G3
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: BOLL (NP_149019, 80 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: FETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIY
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: BOLL
• Gene Full Name: boule homolog, RNA binding protein
• Alias Symbols: bol, boule-like;BOULE;boule-like RNA binding protein;protein boule-like.
• NCBI Gene Id: 66037
• Protein Name: Homo sapiens boule homolog, RNA binding protein (BOLL), transcript variant 2, mRNA|protein boule-like isoform 2 [Homo sapiens]
• Description of Target: This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_149019
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_033030