
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BIRC7 (AVARP02033_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Cow, Dog, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BIRC7 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 84%; Human: 100%; Rabbit: 92% |
Peptide Sequence | Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-BIRC7 (AVARP02033_P050) antibody is Catalog # AAP30562 (Previous Catalog # AAPP01214) |
Reference | Dynek,J.N., (2008) Cancer Res. 68 (9), 3124-3132 |
Gene Symbol | BIRC7 |
---|---|
Gene Full Name | Baculoviral IAP repeat containing 7 |
Alias Symbols | KIAP, LIVIN, MLIAP, RNF50, ML-IAP |
NCBI Gene Id | 79444 |
Protein Name | Baculoviral IAP repeat-containing protein 7 |
Description of Target | BIRC7 protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide. |
Uniprot ID | Q96CA5 |
Protein Accession # | NP_647478 |
Nucleotide Accession # | NM_139317 |
Protein Size (# AA) | 298 |
Molecular Weight | 33kDa |
Protein Interactions | FAM124B; DIABLO; POLR1C; UBE2D2; PHF1; DDX6; CASP9; BIRC2; AES; CASP3; RAF1; XIAP; TAB1; HTRA2; UBC; BIRC7; UBE2I; UBE2E1; UBE2D3; UBE2D1; UBE2K; CASP7; XAF1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Rabbit".
-
How long will it take to receive "BIRC7 Antibody - middle region (AVARP02033_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "BIRC7 Antibody - middle region (AVARP02033_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
This target may also be called "KIAP, LIVIN, MLIAP, RNF50, ML-IAP" in publications.
-
What is the shipping cost for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "33kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BIRC7 Antibody - middle region (AVARP02033_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BIRC7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BIRC7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BIRC7"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BIRC7"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BIRC7"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BIRC7"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.