BIRC7 Antibody - middle region (AVARP02033_P050)

• Product Number: AVARP02033_P050
• Name: BIRC7 Antibody - middle region (AVARP02033_P050)
• Protein Size (# AA): 298 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 79444
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Baculoviral IAP repeat containing 7
• Alias Symbols: KIAP, LIVIN, MLIAP, RNF50, ML-IAP
• Peptide Sequence: Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Dynek,J.N., (2008) Cancer Res. 68 (9), 3124-3132
• Description of Target: BIRC7 protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide.
• Protein Interactions: FAM124B; DIABLO; POLR1C; UBE2D2; PHF1; DDX6; CASP9; BIRC2; AES; CASP3; RAF1; XIAP; TAB1; HTRA2; UBC; BIRC7; UBE2I; UBE2E1; UBE2D3; UBE2D1; UBE2K; CASP7; XAF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BIRC7 (AVARP02033_P050) antibody is Catalog # AAP30562 (Previous Catalog # AAPP01214)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BIRC7
• Uniprot ID: Q96CA5
• Protein Name: Baculoviral IAP repeat-containing protein 7
• Protein Accession #: NP_647478
• Purification: Affinity Purified
• Nucleotide Accession #: NM_139317
• Tested Species Reactivity: Human
• Gene Symbol: BIRC7
• Predicted Species Reactivity: Human, Cow, Dog, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 84%; Human: 100%; Rabbit: 92%
• Image 1: Human THP-1
  
  WB Suggested Anti-BIRC7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: THP-1 cell lysate