BIRC7 Antibody - middle region : HRP (AVARP02033_P050-HRP)

Catalog No: AVARP02033_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Cow, Dog, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BIRC7
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 84%; Human: 100%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BIRC7 (AVARP02033_P050-HRP) antibody is Catalog # AAP30562 (Previous Catalog # AAPP01214)
• Reference: Dynek,J.N., (2008) Cancer Res. 68 (9), 3124-3132

Target Info

• Gene Symbol: BIRC7
• Gene Full Name: Baculoviral IAP repeat containing 7
• Alias Symbols: KIAP, LIVIN, MLIAP, RNF50, ML-IAP
• NCBI Gene Id: 79444
• Protein Name: Baculoviral IAP repeat-containing protein 7
• Description of Target: BIRC7 protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and NR2C2/TAK1. In vitro, inhibits caspase-3 and proteolytic activation of pro-caspase-9. Isoform 1 blocks staurosporine-induced apoptosis. Isoform 2 blocks etoposide-induced apoptosis.The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide.
• Uniprot ID: Q96CA5
• Protein Accession #: NP_647478
• Nucleotide Accession #: NM_139317
• Protein Size (# AA): 298
• Molecular Weight: 33kDa
• Protein Interactions: FAM124B; DIABLO; POLR1C; UBE2D2; PHF1; DDX6; CASP9; BIRC2; AES; CASP3; RAF1; XIAP; TAB1; HTRA2; UBC; BIRC7; UBE2I; UBE2E1; UBE2D3; UBE2D1; UBE2K; CASP7; XAF1;