ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: OAAJ02958
Size:100 ul
Price: $319.00
SKU
OAAJ02958
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BCL2 (OAAJ02958) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat
Product FormatLiquid. PBS (pH 7.4) 150mM NaCl, 0.02% sodium azide and 50% glycerol.
ClonalityPolyclonal
IsotypeIgG
HostRabbit
ApplicationWB, IHC, IF, ICC
::Function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).
Subcellular Location: Mitochondrion outer membrane, Single-pass membrane protein Nucleus membrane, Single-pass membrane protein Endoplasmic reticulum membrane, Single-pass membrane protein.
Tissue Specificity: Expressed in a variety of tissues.
Subunit Structure: Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity (PubMed:8183370). Interacts with EI24 (By similarity). Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with BOP. Interacts with the SCF(FBXO10) complex. Interacts (via the loop between motifs BH4 and BH3) with NLRP1 (via LRR repeats), but not with NLRP2, NLRP3, NLRP4, PYCARD, nor MEFV (PubMed:17418785).
Reconstitution and StorageStore at -20C. Stable for 12 months from date of receipt.
ImmunogenA synthesized peptide derived from human BCL-2
PurificationImmunogen affinity purified
Peptide SequenceMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Concentration1 mg/ml
Target Post-Translational ModificationPhosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-87, wich stimulates starvation-induced autophagy. Dephosphorylated by protein phosphatase 2A (PP2A) (By similarity).Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.Monoubiquitinated by PRKN, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome.
SpecificityBCL-2 antibody detects endogenous levels of total BCL-2.
Intended UseFor research use only.
Application InfoWB: 1:500~2000
IHC: 1:50~200
IF/ICC: 1:100~500
Gene SymbolBCL2
Gene Full NameB-cell CLL/lymphoma 2
Alias SymbolsBcl-2, PPP1R50
NCBI Gene Id596
Description of TargetThis gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends.
Uniprot IDP10415
Molecular Weight28 kDa
  1. What is the species homology for "BCL2 Antibody (OAAJ02958)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat".

  2. How long will it take to receive "BCL2 Antibody (OAAJ02958)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "BCL2 Antibody (OAAJ02958)" provided in?

    This item is provided in "Liquid. PBS (pH 7.4) 150mM NaCl, 0.02% sodium azide and 50% glycerol.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BCL2 Antibody (OAAJ02958)"?

    This target may also be called "Bcl-2, PPP1R50" in publications.

  5. What is the shipping cost for "BCL2 Antibody (OAAJ02958)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BCL2 Antibody (OAAJ02958)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BCL2 Antibody (OAAJ02958)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BCL2 Antibody (OAAJ02958)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BCL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BCL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BCL2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BCL2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BCL2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BCL2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BCL2 Antibody (OAAJ02958)
Your Rating
We found other products you might like!