| Product Number |
OAAJ02958 |
| Product Page |
www.avivasysbio.com/bcl2-antibody-oaaj02958.html |
| Name |
BCL2 Antibody (OAAJ02958) |
| Molecular Weight |
28 kDa |
| Isotype |
IgG |
| NCBI Gene Id |
596 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1 mg/ml |
| Gene Full Name |
B-cell CLL/lymphoma 2 |
| Alias Symbols |
Bcl-2, PPP1R50 |
| Peptide Sequence |
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Product Format |
Liquid. PBS (pH 7.4) 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Description of Target |
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Two transcript variants, produced by alternate splicing, differ in their C-terminal ends. |
| Reconstitution and Storage |
Store at -20C. Stable for 12 months from date of receipt. |
| Datasheets/Manuals |
Printable datasheet for anti-BCL2 (OAAJ02958) antibody |
| Specificity |
BCL-2 antibody detects endogenous levels of total BCL-2. |
| Additional Information |
Function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).
Subcellular Location: Mitochondrion outer membrane, Single-pass membrane protein Nucleus membrane, Single-pass membrane protein Endoplasmic reticulum membrane, Single-pass membrane protein.
Tissue Specificity: Expressed in a variety of tissues.
Subunit Structure: Forms homodimers, and heterodimers with BAX, BAD, BAK and Bcl-X(L). Heterodimerization with BAX requires intact BH1 and BH2 motifs, and is necessary for anti-apoptotic activity (PubMed:8183370). Interacts with EI24 (By similarity). Also interacts with APAF1, BBC3, BCL2L1, BNIPL, MRPL41 and TP53BP2. Binding to FKBP8 seems to target BCL2 to the mitochondria and probably interferes with the binding of BCL2 to its targets. Interacts with BAG1 in an ATP-dependent manner. Interacts with RAF1 (the 'Ser-338' and 'Ser-339' phosphorylated form). Interacts (via the BH4 domain) with EGLN3; the interaction prevents the formation of the BAX-BCL2 complex and inhibits the anti-apoptotic activity of BCL2. Interacts with G0S2; this interaction also prevents the formation of the anti-apoptotic BAX-BCL2 complex. Interacts with BOP. Interacts with the SCF(FBXO10) complex. Interacts (via the loop between motifs BH4 and BH3) with NLRP1 (via LRR repeats), but not with NLRP2, NLRP3, NLRP4, PYCARD, nor MEFV (PubMed:17418785).
|
| Application Info |
WB: 1:500~2000
IHC: 1:50~200
IF/ICC: 1:100~500
|
| Immunogen |
A synthesized peptide derived from human BCL-2 |
| Intended Use |
For research use only. |
| Uniprot ID |
P10415 |
| Purification |
Immunogen affinity purified |
| Target Post-Translational Modification |
Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity. Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle. In the absence of growth factors, BCL2 appears to be phosphorylated by other protein kinases such as ERKs and stress-activated kinases. Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-87, wich stimulates starvation-induced autophagy. Dephosphorylated by protein phosphatase 2A (PP2A) (By similarity).Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity, causes the release of cytochrome c into the cytosol promoting further caspase activity.Monoubiquitinated by PRKN, leading to increase its stability. Ubiquitinated by SCF(FBXO10), leading to its degradation by the proteasome. |
| Gene Symbol |
BCL2 |
| Predicted Species Reactivity |
Human, Mouse, Rat |
| Application |
WB, IHC, IF, ICC |
| Image 1 | K562 whole cell lysates
 | Western blot analysis of BCL-2 expression in K562 whole cell lysates. The lane on the left is treated with the antigen-specific peptide. |
|
|
