- Tested Species Reactivity:
- Mouse
- Predicted Species Reactivity:
- Dog, Horse, Human, Mouse, Rabbit, Rat
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- Aplnr
- Official Gene Full Name:
- Apelin receptor
- NCBI Gene Id:
- 23796
- Protein Name:
- Apelin receptor
- Swissprot Id:
- Q9WV08
- Protein Accession #:
- NP_035914
- Nucleotide Accession #:
- NM_011784
- Alias Symbols:
- APJ, Agtrl1, msr/apj
- Replacement Item:
- This antibody may replace item sc-115189 from Santa Cruz Biotechnology.
- Description of Target:
- Aplnr is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity.
- Protein Size (# AA):
- 377
- Molecular Weight:
- 42kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express Aplnr.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express Aplnr.
- Predicted Homology Based on Immunogen Sequence:
- Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 86%
- Complete computational species homology data:
- Anti-Aplnr (ARP59984_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-Aplnr (ARP59984_P050) antibody is Catalog # AAP59984
- Datasheets/Manuals:
- Printable datasheet for anti-Aplnr (ARP59984_P050) antibody
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
