Aplnr Antibody - C-terminal region (ARP59984_P050)

Catalog#: ARP59984_P050

• Size: 100 ul

• Gene Symbol: Aplnr
• Official Gene Full Name: Apelin receptor
• NCBI Gene Id: 23796
• Protein Name: Apelin receptor
• Swissprot Id: Q9WV08
• Protein Accession #: NP_035914
• Nucleotide Accession #: NM_011784
• Alias Symbols: APJ, Agtrl1, msr/apj
• Replacement Item: This antibody may replace item sc-115189 from Santa Cruz Biotechnology.
• Description of Target: Aplnr is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity.
• Protein Size (# AA): 377
• Molecular Weight: 42kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express Aplnr.
• Predicted Species Reactivity: Dog, Horse, Human, Mouse, Rabbit, Rat
• Tested Species Reactivity: Mouse
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-Aplnr (ARP59984_P050) antibody is Catalog # AAP59984

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.