Search Antibody, Protein, and ELISA Kit Solutions

Aplnr Antibody - C-terminal region (ARP59984_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP59984_P050-FITC Conjugated

ARP59984_P050-HRP Conjugated

ARP59984_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Apelin receptor
NCBI Gene Id:
Protein Name:
Apelin receptor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
APJ, Agtrl1, msr/apj
Replacement Item:
This antibody may replace item sc-115189 from Santa Cruz Biotechnology.
Description of Target:
Aplnr is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Aplnr.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Aplnr.
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 86%
Complete computational species homology data:
Anti-Aplnr (ARP59984_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Aplnr (ARP59984_P050) antibody is Catalog # AAP59984
Printable datasheet for anti-Aplnr (ARP59984_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...