Catalog No: ARP59985_P050
Price: $0.00
SKU
ARP59985_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-APLNR (ARP59985_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human APLNR
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW
Concentration0.5 mg/ml
Blocking PeptideFor anti-APLNR (ARP59985_P050) antibody is Catalog # AAP59985 (Previous Catalog # AAPP46142)
Gene SymbolAPLNR
Gene Full NameApelin receptor
Alias SymbolsAPJ, APJR, HG11, AGTRL1
NCBI Gene Id187
Protein NameApelin receptor
Description of TargetThis gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified.
Uniprot IDP35414
Protein Accession #NP_005152
Nucleotide Accession #NM_005161
Protein Size (# AA)380
Molecular Weight43kDa
Protein InteractionsAPLN;
  1. What is the species homology for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "APLNR Antibody - N-terminal region (ARP59985_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    This target may also be called "APJ, APJR, HG11, AGTRL1" in publications.

  5. What is the shipping cost for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "APLNR Antibody - N-terminal region (ARP59985_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "APLNR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "APLNR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "APLNR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "APLNR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "APLNR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "APLNR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:APLNR Antibody - N-terminal region (ARP59985_P050)
Your Rating
We found other products you might like!