Aplnr Antibody - C-terminal region (ARP59984_P050)

• Product Number: ARP59984_P050
• Name: Aplnr Antibody - C-terminal region (ARP59984_P050)
• Protein Size (# AA): 377 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 23796
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Apelin receptor
• Alias Symbols: A, APJ, Agt, Agtrl1, msr/apj
• Peptide Sequence: Synthetic peptide located within the following region: CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Aplnr is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-Aplnr (ARP59984_P050) antibody is Catalog # AAP59984
• Uniprot ID: Q9WV08
• Protein Name: Apelin receptor
• Protein Accession #: NP_035914
• Purification: Affinity Purified
• Nucleotide Accession #: NM_011784
• Tested Species Reactivity: Mouse
• Gene Symbol: Aplnr
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 86%
• Image 1: Mouse Pancreas
  
  WB Suggested Anti-Aplnr Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Pancreas