Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF142 antibody - C-terminal region (ARP38554_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP38554_P050-FITC Conjugated

ARP38554_P050-HRP Conjugated

ARP38554_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
ZNF142
NCBI Gene Id:
7701
Official Gene Full Name:
Zinc finger protein 142
Swissprot Id:
A8MWU9
Protein Accession #:
NP_005072
Nucleotide Accession #:
NM_005081
Alias Symbols:
pHZ-49
Description of Target:
The function of ZNF142 remains unknown.
Protein Size (# AA):
1524
Molecular Weight:
171kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF142.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF142.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF142
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ZNF142 (ARP38554_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CHMP5; UBC; MAPK14;
Blocking Peptide:
For anti-ZNF142 (ARP38554_P050) antibody is Catalog # AAP38554 (Previous Catalog # AAPP20745)
Datasheets/Manuals:
Printable datasheet for anti-ZNF142 (ARP38554_P050) antibody
Sample Type Confirmation:

ZNF142 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Publications:

Ross, E; Ata, R; Thavarajah, T; Medvedev, S; Bowden, P; Marshall, JG; Antonescu, CN; AMP-Activated Protein Kinase Regulates the Cell Surface Proteome and Integrin Membrane Traffic. 10, e0128013 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26010094

Tell us what you think about this item!

Write A Review
    Please, wait...