Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38554_P050-FITC Conjugated

ARP38554_P050-HRP Conjugated

ARP38554_P050-Biotin Conjugated

ZNF142 Antibody - C-terminal region (ARP38554_P050)

Catalog#: ARP38554_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ZNF142
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-ZNF142 (ARP38554_P050)
Peptide SequenceSynthetic peptide located within the following region: YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-ZNF142 (ARP38554_P050) antibody is Catalog # AAP38554 (Previous Catalog # AAPP20745)
Datasheets/ManualsPrintable datasheet for anti-ZNF142 (ARP38554_P050) antibody
Sample Type Confirmation

ZNF142 is strongly supported by BioGPS gene expression data to be expressed in MCF7


Ross, E; Ata, R; Thavarajah, T; Medvedev, S; Bowden, P; Marshall, JG; Antonescu, CN; AMP-Activated Protein Kinase Regulates the Cell Surface Proteome and Integrin Membrane Traffic. 10, e0128013 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26010094

Gene SymbolZNF142
Official Gene Full NameZinc finger protein 142
Alias SymbolspHZ-49
NCBI Gene Id7701
Description of TargetThe function of ZNF142 remains unknown.
Swissprot IdA8MWU9
Protein Accession #NP_005072
Nucleotide Accession #NM_005081
Protein Size (# AA)1524
Molecular Weight171kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express ZNF142.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express ZNF142.
Protein InteractionsCHMP5; UBC; MAPK14;
Write Your Own Review
You're reviewing:ZNF142 Antibody - C-terminal region (ARP38554_P050)
Your Rating
Aviva Tissue Tool
Aviva Blast Tool
Aviva HIS tag Deal
Aviva Tips and Tricks