Search Antibody, Protein, and ELISA Kit Solutions

ZNF142 Antibody - C-terminal region (ARP38554_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38554_P050-FITC Conjugated

ARP38554_P050-HRP Conjugated

ARP38554_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF142
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-ZNF142 (ARP38554_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ZNF142 (ARP38554_P050) antibody is Catalog # AAP38554 (Previous Catalog # AAPP20745)
Datasheets/Manuals:
Printable datasheet for anti-ZNF142 (ARP38554_P050) antibody
Sample Type Confirmation:

ZNF142 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Publications:

Ross, E; Ata, R; Thavarajah, T; Medvedev, S; Bowden, P; Marshall, JG; Antonescu, CN; AMP-Activated Protein Kinase Regulates the Cell Surface Proteome and Integrin Membrane Traffic. 10, e0128013 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26010094

Gene Symbol:
ZNF142
Official Gene Full Name:
Zinc finger protein 142
Alias Symbols:
pHZ-49
NCBI Gene Id:
7701
Description of Target:
The function of ZNF142 remains unknown.
Swissprot Id:
A8MWU9
Protein Accession #:
NP_005072
Nucleotide Accession #:
NM_005081
Protein Size (# AA):
1524
Molecular Weight:
171kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF142.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF142.
Protein Interactions:
CHMP5; UBC; MAPK14;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...