ZNF142 Antibody - C-terminal region (ARP38554_P050)

Data Sheet
 
Product Number ARP38554_P050
Product Page www.avivasysbio.com/znf142-antibody-c-terminal-region-arp38554-p050.html
Name ZNF142 Antibody - C-terminal region (ARP38554_P050)
Protein Size (# AA) 1524 amino acids
Molecular Weight 171kDa
NCBI Gene Id 7701
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 142
Alias Symbols HA4654, pHZ-49, NEDISHM
Peptide Sequence Synthetic peptide located within the following region: YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of ZNF142 remains unknown.
Protein Interactions CHMP5; UBC; MAPK14;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF142 (ARP38554_P050) antibody
Blocking Peptide For anti-ZNF142 (ARP38554_P050) antibody is Catalog # AAP38554 (Previous Catalog # AAPP20745)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF142
Uniprot ID A8MWU9
Publications

AMP-Activated Protein Kinase Regulates the Cell Surface Proteome and Integrin Membrane Traffic. PLoS ONE. 10, e0128013 (2015). 26010094

Sample Type Confirmation

ZNF142 is strongly supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_005072
Purification Affinity Purified
Nucleotide Accession # NM_005081
Tested Species Reactivity Human
Gene Symbol ZNF142
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Adult Liver
Rabbit Anti-ZNF142 Antibody
Catalog Number: ARP38554_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm, Membrane in hepatocytes, strong signal, low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 2
Human MCF7
WB Suggested Anti-ZNF142 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysateZNF142 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com