Product Number |
ARP38554_P050 |
Product Page |
www.avivasysbio.com/znf142-antibody-c-terminal-region-arp38554-p050.html |
Name |
ZNF142 Antibody - C-terminal region (ARP38554_P050) |
Protein Size (# AA) |
1524 amino acids |
Molecular Weight |
171kDa |
NCBI Gene Id |
7701 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 142 |
Alias Symbols |
HA4654, pHZ-49, NEDISHM |
Peptide Sequence |
Synthetic peptide located within the following region: YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of ZNF142 remains unknown. |
Protein Interactions |
CHMP5; UBC; MAPK14; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF142 (ARP38554_P050) antibody |
Blocking Peptide |
For anti-ZNF142 (ARP38554_P050) antibody is Catalog # AAP38554 (Previous Catalog # AAPP20745) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF142 |
Uniprot ID |
A8MWU9 |
Publications |
AMP-Activated Protein Kinase Regulates the Cell Surface Proteome and Integrin Membrane Traffic. PLoS ONE. 10, e0128013 (2015). 26010094 |
Sample Type Confirmation |
ZNF142 is strongly supported by BioGPS gene expression data to be expressed in MCF7 |
Protein Accession # |
NP_005072 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005081 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF142 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Adult Liver
| Rabbit Anti-ZNF142 Antibody
Catalog Number: ARP38554_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm, Membrane in hepatocytes, strong signal, low tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
| Image 2 | Human MCF7
| WB Suggested Anti-ZNF142 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: MCF7 cell lysateZNF142 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells |
|
|