ZNF142 Peptide - C-terminal region (AAP38554)

Data Sheet
 
Sku AAP38554
Old sku AAPP20745
Price $99.00
Name ZNF142 Peptide - C-terminal region (AAP38554)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene ZNF142
Alias symbols pHZ-49
Gene id 7701
Description of target The function of ZNF142 remains unknown.
Swissprot id A8MWU9
Protein accession num NP_005072
Nucleotide accession num NM_005081
Protein size 1524 amino acids
Molecular weight 171kDa
Species reactivity Human
Application IHC, WB
Peptide sequence YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA
Partner proteins CHMP5,MAPK14
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-ZNF142 Antibody (ARP38554_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com