Sku |
AAP38554 |
Old sku |
AAPP20745 |
Price |
$99.00 |
Name |
ZNF142 Peptide - C-terminal region (AAP38554) |
Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
Size |
100ug |
Gene |
ZNF142 |
Alias symbols |
pHZ-49 |
Gene id |
7701 |
Description of target |
The function of ZNF142 remains unknown. |
Swissprot id |
A8MWU9 |
Protein accession num |
NP_005072 |
Nucleotide accession num |
NM_005081 |
Protein size |
1524 amino acids |
Molecular weight |
171kDa |
Species reactivity |
Human |
Application |
IHC, WB |
Peptide sequence |
YKAKQKFQVVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPA |
Partner proteins |
CHMP5,MAPK14 |
Quality control |
The peptide is characterized by mass spectroscopy |
Key reference |
N/A |
Description |
This is a synthetic peptide designed for use in combination with anti-ZNF142 Antibody (ARP38554_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
Product format |
Lyophilized powder |
Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
Protocol |
|
Tips |
See our General FAQ page. |
Availability |
In Stock |