WRN Antibody (OAAL00355)

Catalog No: OAAL00355

Size:100UG

WRN monoclonal antibody (M06), clone 2F7. Western Blot analysis of WRN expression in Jurkat.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2F7
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: WRN (NP_000544, 1322 a.a. ~ 1432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: WRN
• Gene Full Name: WRN RecQ like helicase
• Alias Symbols: DNA helicase, RecQ-like type 3;exonuclease WRN;recQ protein-like 2;RECQ3;RECQL2;RECQL3;Werner syndrome ATP-dependent helicase;Werner syndrome RecQ like helicase;Werner syndrome, RecQ helicase-like.
• NCBI Gene Id: 7486
• Protein Name: Homo sapiens Werner syndrome RecQ like helicase (WRN), mRNA|Werner syndrome ATP-dependent helicase [Homo sapiens]
• Description of Target: This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3' to 5' DNA helicase activity, and is also a 3' to 5' exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_000544
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_000553