Search Antibody, Protein, and ELISA Kit Solutions

WASL Antibody - middle region (ARP63498_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63498_P050-FITC Conjugated

ARP63498_P050-HRP Conjugated

ARP63498_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
WASL
Official Gene Full Name:
Wiskott-Aldrich syndrome-like
NCBI Gene Id:
8976
Protein Name:
Neural Wiskott-Aldrich syndrome protein
Swissprot Id:
O00401
Protein Accession #:
NP_003932
Nucleotide Accession #:
NM_003941
Alias Symbols:
DKFZp779G0847, MGC48327, N-WASP, NWASP
Replacement Item:
This antibody may replace item sc-100964 from Santa Cruz Biotechnology.
Description of Target:
The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.
Protein Size (# AA):
505
Molecular Weight:
56kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express WASL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express WASL.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-WASL (ARP63498_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RHOJ; ARPC3; RNF8; NCK2; WIPF1; SDCBP; PTK6; GRB2; IQGAP1; WWOX; SNX9; APBB1; PRPF40A; FNBP1L; FNBP1; TRIP10; PSTPIP1; ACTG1; SORBS3; ACTR2; ACTR3; LCK; CDC42; RPL7AP66; ZNF395; BAIAP2; ARPC1B; FCHSD2; IPO5; HP; HSP90AB1; HSP90AA1; SRC; WASF2; APP; WIPF2;
Blocking Peptide:
For anti-WASL (ARP63498_P050) antibody is Catalog # AAP63498
Datasheets/Manuals:
Printable datasheet for anti-WASL (ARP63498_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...