Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP63498_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP63498_P050-FITC Conjugated

ARP63498_P050-HRP Conjugated

ARP63498_P050-Biotin Conjugated

WASL Antibody - middle region (ARP63498_P050)

Catalog#: ARP63498_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100964 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-WASL (ARP63498_P050)
Peptide Sequence Synthetic peptide located within the following region: ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-WASL (ARP63498_P050) antibody is Catalog # AAP63498
Datasheets/Manuals Printable datasheet for anti-WASL (ARP63498_P050) antibody
Gene Symbol WASL
Official Gene Full Name Wiskott-Aldrich syndrome-like
Alias Symbols DKFZp779G0847, MGC48327, N-WASP, NWASP
NCBI Gene Id 8976
Protein Name Neural Wiskott-Aldrich syndrome protein
Description of Target The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.
Swissprot Id O00401
Protein Accession # NP_003932
Nucleotide Accession # NM_003941
Protein Size (# AA) 505
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express WASL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express WASL.
Protein Interactions RHOJ; ARPC3; RNF8; NCK2; WIPF1; SDCBP; PTK6; GRB2; IQGAP1; WWOX; SNX9; APBB1; PRPF40A; FNBP1L; FNBP1; TRIP10; PSTPIP1; ACTG1; SORBS3; ACTR2; ACTR3; LCK; CDC42; RPL7AP66; ZNF395; BAIAP2; ARPC1B; FCHSD2; IPO5; HP; HSP90AB1; HSP90AA1; SRC; WASF2; APP; WIPF2;
  1. What is the species homology for "WASL Antibody - middle region (ARP63498_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "WASL Antibody - middle region (ARP63498_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "WASL Antibody - middle region (ARP63498_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "WASL Antibody - middle region (ARP63498_P050)"?

    This target may also be called "DKFZp779G0847, MGC48327, N-WASP, NWASP" in publications.

  5. What is the shipping cost for "WASL Antibody - middle region (ARP63498_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "WASL Antibody - middle region (ARP63498_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "WASL Antibody - middle region (ARP63498_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "WASL Antibody - middle region (ARP63498_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "WASL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "WASL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "WASL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "WASL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "WASL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "WASL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:WASL Antibody - middle region (ARP63498_P050)
Your Rating