| Sku |
AAP63498 |
| Price |
$99.00 |
| Name |
WASL Peptide - middle region (AAP63498) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
WASL |
| Alias symbols |
DKFZp779G0847, MGC48327, N-WASP, NWASP |
| Gene id |
8976 |
| Description of target |
The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes. |
| Swissprot id |
O00401 |
| Protein accession num |
NP_003932 |
| Nucleotide accession num |
NM_003941 |
| Protein size |
505 amino acids |
| Molecular weight |
56kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
ISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPE |
| Partner proteins |
FNBP1L,HSP90AA1,HSP90AB1,src,APBB1,CDC42,CTTN,DNMBP,FYN,GRB2,ITSN1,NCK1,PACSIN1,PACSIN2,PACSIN3,PFN1,PRPF40A,RHOQ,VIPR1,WIPF1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-WASL Antibody (ARP63498_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
