TNFSF13B Recombinant Protein (Human) (OPCA04041)

Catalog No: OPCA04041

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
• Protein Sequence: QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 68-285 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: TALL-1 is a novel member of the TNF family that is down-regulated by mitogens.Shu H.-B., Hu W.-H., Johnson H.J. Leukoc. Biol. 65:680-683(1999)

Target Info

• Gene Symbol: TNFSF13B
• Gene Full Name: TNF superfamily member 13b
• Alias Symbols: ApoL related ligand TALL-1;B lymphocyte stimulator;BAFF;B-cell-activating factor;B-lymphocyte stimulator;BLYS;CD257;delta BAFF;Delta4 BAFF;dendritic cell-derived TNF-like molecule;DTL;epididymis secretory sperm binding protein;TALL1;TALL-1;THANK;TNF and ApoL-related leukocyte expressed ligand 1;TNF- and APOL-related leukocyte expressed ligand 1;TNF homolog that activates apoptosis;TNFSF20;TNLG7A;tumor necrosis factor (ligand) superfamily, member 13b;tumor necrosis factor (ligand) superfamily, member 20;tumor necrosis factor ligand 7A;tumor necrosis factor ligand superfamily member 13B;tumor necrosis factor superfamily member 13b;tumor necrosis factor-like protein ZTNF4;ZTNF4.
• NCBI Gene Id: 10673
• Protein Name: Tumor necrosis factor ligand superfamily member 13B
• Description of Target: Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.
• Uniprot ID: Q9Y275
• Protein Accession #: NP_001139117
• Nucleotide Accession #: NM_001145645
• Protein Size (# AA): Recombinant
• Molecular Weight: 39.7 kDa