Search Antibody, Protein, and ELISA Kit Solutions

TNFAIP8L2 Antibody - N-terminal region : FITC (ARP66707_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP66707_P050 Unconjugated

ARP66707_P050-HRP Conjugated

ARP66707_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-366309 from Santa Cruz Biotechnology.
Description of Target:
TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. It is a negative regulator of Toll-like receptor and T-cell receptor function. It prevents hyperresponsiveness of the immune system and maintains immune homeostasis and inhibits JUN/AP1 and NF-kappa-B activation. TNFAIP8L2 promotes Fas-induced apoptosis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TNFAIP8L2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TNFAIP8L2.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP8L2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-TNFAIP8L2 (ARP66707_P050-FITC) antibody is Catalog # AAP66707
Printable datasheet for anti-TNFAIP8L2 (ARP66707_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...