| Product Number |
ARP66707_P050-FITC |
| Product Page |
www.avivasysbio.com/tnfaip8l2-antibody-n-terminal-region-fitc-arp66707-p050-fitc.html |
| Name |
TNFAIP8L2 Antibody - N-terminal region : FITC (ARP66707_P050-FITC) |
| Protein Size (# AA) |
148 amino acids |
| Molecular Weight |
20kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
79626 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
TIPE2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. It is a negative regulator of Toll-like receptor and T-cell receptor function. It prevents hyperresponsiveness of the immune system and maintains immune homeostasis and inhibits JUN/AP1 and NF-kappa-B activation. TNFAIP8L2 promotes Fas-induced apoptosis. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-TNFAIP8L2 (ARP66707_P050-FITC) antibody |
| Blocking Peptide |
For anti-TNFAIP8L2 (ARP66707_P050-FITC) antibody is Catalog # AAP66707 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNFAIP8L2 |
| Uniprot ID |
Q6P589 |
| Purification |
Affinity Purified |
| Gene Symbol |
TNFAIP8L2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | |
|
