TNFAIP8L2 Peptide - N-terminal region (AAP66707)

Data Sheet
 
Sku AAP66707
Price $99.00
Name TNFAIP8L2 Peptide - N-terminal region (AAP66707)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene TNFAIP8L2
Alias symbols TNFAIP8L2,
Gene id 79626
Description of target TNFAIP8L2 acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. It is a negative regulator of Toll-like receptor and T-cell receptor function. It prevents hyperresponsiveness of the immune system and maintains immune homeostasis and inhibits JUN/AP1 and NF-kappa-B activation. TNFAIP8L2 promotes Fas-induced apoptosis.
Swissprot id Q6P589
Protein size 148 amino acids
Molecular weight 20kDa
Species reactivity Human
Application WB
Peptide sequence Synthetic peptide located within the following region: LQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-TNFAIP8L2 Antibody (ARP66707_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com