TNF Recombinant Protein (Woodchuck) (OPCA05449)

Catalog No: OPCA05449

Product Info

• Predicted Species Reactivity: Marmota monax|Woodchuck
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Marmota monax (Woodchuck)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL
• Protein Sequence: GPQREEFLNNLPLSPQAQMLTLRSSSQNMNDKPVAHVVAKNEDKEQLVWLSRRANALLANGMELIDNQLVVPANGLYLVYSQVLFKGQGCPSYVLLTHTVSRFAVSYQDKVNLLSAIKSPCPKESLEGAEFKPWYEPIYLGGVFELQKGDRLSAEVNLPSYLDFAESGQVYFGVIAL
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Baculovirus
• Protein Range: 57-233 aa
• Tag: N-terminal 10xHis-tagged
• Reference: Woodchuck lymphotoxin-alpha, -beta and tumor necrosis factor genes: structure, characterization and biological activity. Li D.H., Havell E.A., Brown C.L., Cullen J.M. Gene 242:295-305(2000)

Target Info

• Gene Symbol: TNF
• Alias Symbols: Cachectin;TNF-alpha;Tumor necrosis factor ligand superfamily member 2.
• Protein Name: Tumor necrosis factor
• Description of Target: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
• Uniprot ID: O35734
• Protein Size (# AA): Recombinant
• Molecular Weight: 22.2 kDa