Search Antibody, Protein, and ELISA Kit Solutions

TBCE Antibody - C-terminal region : FITC (ARP61756_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP61756_P050 Unconjugated

ARP61756_P050-HRP Conjugated

ARP61756_P050-Biotin Conjugated

Gene Symbol:
TBCE
NCBI Gene Id:
6905
Swissprot Id:
Q15813
Protein Accession #:
NP_003184
Alias Symbols:
TBCE,
Replacement Item:
This antibody may replace item sc-103897 from Santa Cruz Biotechnology.
Description of Target:
Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
527
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TBCE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TBCE.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBCE
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: VLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
RPN10; TUB1; UBC; OGFOD1; TRNT1; GNPDA1; RAD23A; PYGL; AHCY; TBCD; TUBA4A;
Blocking Peptide:
For anti-TBCE (ARP61756_P050-FITC) antibody is Catalog # AAP61756
Datasheets/Manuals:
Printable datasheet for anti-TBCE (ARP61756_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...