TBCE Antibody - C-terminal region : FITC (ARP61756_P050-FITC)

Data Sheet
 
Product Number ARP61756_P050-FITC
Product Page www.avivasysbio.com/tbce-antibody-c-terminal-region-fitc-arp61756-p050-fitc.html
Name TBCE Antibody - C-terminal region : FITC (ARP61756_P050-FITC)
Protein Size (# AA) 527 amino acids
Molecular Weight 57kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 6905
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols HRD, KCS, KCS1, pac2, PEAMO
Peptide Sequence Synthetic peptide located within the following region: VLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene.
Protein Interactions RPN10; TUB1; UBC; OGFOD1; TRNT1; GNPDA1; RAD23A; PYGL; AHCY; TBCD; TUBA4A;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TBCE (ARP61756_P050-FITC) antibody
Blocking Peptide For anti-TBCE (ARP61756_P050-FITC) antibody is Catalog # AAP61756
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBCE
Uniprot ID Q15813
Protein Accession # NP_003184
Purification Affinity Purified
Gene Symbol TBCE
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com