Product Number |
ARP61756_P050-FITC |
Product Page |
www.avivasysbio.com/tbce-antibody-c-terminal-region-fitc-arp61756-p050-fitc.html |
Name |
TBCE Antibody - C-terminal region : FITC (ARP61756_P050-FITC) |
Protein Size (# AA) |
527 amino acids |
Molecular Weight |
57kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
6905 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
HRD, KCS, KCS1, pac2, PEAMO |
Peptide Sequence |
Synthetic peptide located within the following region: VLEKQLPGSMTIQKVKGLLSRLLKVPVSDLLLSYESPKKPGREIELENDL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. |
Protein Interactions |
RPN10; TUB1; UBC; OGFOD1; TRNT1; GNPDA1; RAD23A; PYGL; AHCY; TBCD; TUBA4A; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-TBCE (ARP61756_P050-FITC) antibody |
Blocking Peptide |
For anti-TBCE (ARP61756_P050-FITC) antibody is Catalog # AAP61756 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBCE |
Uniprot ID |
Q15813 |
Protein Accession # |
NP_003184 |
Purification |
Affinity Purified |
Gene Symbol |
TBCE |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|