Search Antibody, Protein, and ELISA Kit Solutions

Tbce Antibody - N-terminal region (ARP61755_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP61755_P050-FITC Conjugated

ARP61755_P050-HRP Conjugated

ARP61755_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Tubulin-specific chaperone E
NCBI Gene Id:
Protein Name:
Tubulin-specific chaperone E
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
2610206D02Rik, C530005D02Rik, pmn
Replacement Item:
This antibody may replace item sc-103897 from Santa Cruz Biotechnology.
Description of Target:
Tbce is a rubulin-folding protein; it is involved in the second step of the tubulin folding pathway. Tbce seems to be implicated in the maintenance of the neuronal microtubule network. Tbce is involved in regulation of tubulin heterodimer dissociation.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Tbce.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Tbce.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 92%
Complete computational species homology data:
Anti-Tbce (ARP61755_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Tbce (ARP61755_P050) antibody is Catalog # AAP61755
Printable datasheet for anti-Tbce (ARP61755_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...