TAF1C Antibody (OAAL00428)

Catalog No: OAAL00428

Size:100UG

Western Blot analysis of TAF1C expression in transfected 293T cell line by TAF1C monoclonal antibody (M02), clone 3E6.
Lane 1: TAF1C transfected lysate(85.1 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged TAF1C is 1 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 3E6
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: TAF1C (NP_005670.2, 761 a.a. ~ 869 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: SLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: TAF1C
• Gene Full Name: TATA-box binding protein associated factor, RNA polymerase I subunit C
• Alias Symbols: MGC:39976;RNA polymerase I-specific TBP-associated factor 110 kDa;SL1;SL1, 110kD subunit;TAFI110;TAFI95;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD;TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa;TATA box-binding protein-associated factor 1C;TATA box-binding protein-associated factor RNA polymerase I subunit C;TATA-box binding protein associated factor, RNA polymerase I, C;TBP-associated factor 1C;transcription factor SL1;transcription initiation factor SL1/TIF-IB subunit C.
• NCBI Gene Id: 9013
• Protein Name: Homo sapiens TATA-box binding protein associated factor, RNA polymerase I subunit C (TAF1C), transcript variant 1, mRNA|TATA box-binding protein-associated factor RNA polymerase I subunit C isoform 1 [Homo sapiens]
• Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Two transcripts encoding different isoforms have been identified. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_005670.2
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_005679