Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP42372_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42372_P050-FITC Conjugated

ARP42372_P050-HRP Conjugated

ARP42372_P050-Biotin Conjugated

TAC3 Antibody - middle region (ARP42372_P050)

Catalog#: ARP42372_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292436 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TAC3
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-TAC3 (ARP42372_P050)
Peptide Sequence Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TAC3 (ARP42372_P050) antibody is Catalog # AAP42372 (Previous Catalog # AAPP24724)
Datasheets/Manuals Printable datasheet for anti-TAC3 (ARP42372_P050) antibody
Target Reference Geissbuehler,V., (2008) J. Matern. Fetal. Neonatal. Med. 21 (2), 95-100
Gene Symbol TAC3
Official Gene Full Name Tachykinin 3
Alias Symbols NKB, NKNB, PRO1155, ZNEUROK1
NCBI Gene Id 6866
Protein Name Tachykinin-3
Description of Target Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
Swissprot Id Q9UHF0
Protein Accession # NP_037383
Nucleotide Accession # NM_013251
Protein Size (# AA) 121
Molecular Weight 13kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TAC3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TAC3.
Protein Interactions UBC; CCDC90B; UBR1; FEZ1; IKBKAP; GPRASP1; TACR3; TACR1; TACR2; PTN;
  1. What is the species homology for "TAC3 Antibody - middle region (ARP42372_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "TAC3 Antibody - middle region (ARP42372_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAC3 Antibody - middle region (ARP42372_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAC3 Antibody - middle region (ARP42372_P050)"?

    This target may also be called "NKB, NKNB, PRO1155, ZNEUROK1" in publications.

  5. What is the shipping cost for "TAC3 Antibody - middle region (ARP42372_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAC3 Antibody - middle region (ARP42372_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAC3 Antibody - middle region (ARP42372_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAC3 Antibody - middle region (ARP42372_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TAC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAC3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAC3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAC3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAC3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAC3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAC3 Antibody - middle region (ARP42372_P050)
Your Rating