Search Antibody, Protein, and ELISA Kit Solutions

TAC3 Antibody - middle region (ARP42372_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42372_P050-FITC Conjugated

ARP42372_P050-HRP Conjugated

ARP42372_P050-Biotin Conjugated

Gene Symbol:
TAC3
Official Gene Full Name:
Tachykinin 3
NCBI Gene Id:
6866
Protein Name:
Tachykinin-3
Swissprot Id:
Q9UHF0
Protein Accession #:
NP_037383
Nucleotide Accession #:
NM_013251
Alias Symbols:
NKB, NKNB, PRO1155, ZNEUROK1
Replacement Item:
This antibody may replace item sc-292436 from Santa Cruz Biotechnology.
Description of Target:
Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
Protein Size (# AA):
121
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TAC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TAC3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TAC3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-TAC3 (ARP42372_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CCDC90B; UBR1; FEZ1; IKBKAP; GPRASP1; TACR3; TACR1; TACR2; PTN;
Blocking Peptide:
For anti-TAC3 (ARP42372_P050) antibody is Catalog # AAP42372 (Previous Catalog # AAPP24724)
Datasheets/Manuals:
Printable datasheet for anti-TAC3 (ARP42372_P050) antibody
Target Reference:
Geissbuehler,V., (2008) J. Matern. Fetal. Neonatal. Med. 21 (2), 95-100

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...