TAC3 Antibody - middle region (ARP42372_P050)

• Product Number: ARP42372_P050
• Name: TAC3 Antibody - middle region (ARP42372_P050)
• Protein Size (# AA): 121 amino acids
• Molecular Weight: 13kDa
• NCBI Gene Id: 6866
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tachykinin 3
• Alias Symbols: NK3, NKB, HH10, NKNB, PRO1155, ZNEUROK1, LncZBTB39
• Peptide Sequence: Synthetic peptide located within the following region: RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Geissbuehler,V., (2008) J. Matern. Fetal. Neonatal. Med. 21 (2), 95-100
• Description of Target: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
• Protein Interactions: UBC; CCDC90B; UBR1; FEZ1; IKBKAP; GPRASP1; TACR3; TACR1; TACR2; PTN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TAC3 (ARP42372_P050) antibody is Catalog # AAP42372 (Previous Catalog # AAPP24724)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAC3
• Uniprot ID: Q9UHF0
• Protein Name: Tachykinin-3
• Protein Accession #: NP_037383
• Purification: Affinity Purified
• Nucleotide Accession #: NM_013251
• Tested Species Reactivity: Human
• Gene Symbol: TAC3
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Brain
  
  WB Suggested Anti-TAC3 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human brain