SNCB Antibody - C-terminal region (ARP33883_P050)

Catalog No: ARP33883_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: SYUB
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNCB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SNCB (ARP33883_P050) antibody is Catalog # AAP33883

Target Info

• Gene Symbol: SNCB
• Gene Full Name: synuclein, beta
• Alias Symbols: SNCB, Beta-synuclein
• NCBI Gene Id: 6620
• Protein Name: Beta-synuclein
• Description of Target: The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: Q16143
• Protein Accession #: XP_006714979
• Protein Size (# AA): 134
• Molecular Weight: 14kDa
• Protein Interactions: PLK1; PLK3; Tubb3; Tuba1a; LNX1; HSPA1A; CENPT; SEPT4; GRK5; SNCA; APP; ADRBK1; GRK1; GRK6;