Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33883_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33883_P050-FITC Conjugated

ARP33883_P050-HRP Conjugated

ARP33883_P050-Biotin Conjugated

SNCB Antibody - C-terminal region (ARP33883_P050)

Catalog#: ARP33883_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human SNCB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology dataAnti-SNCB (ARP33883_P050)
Peptide SequenceSynthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-SNCB (ARP33883_P050) antibody is Catalog # AAP33883
Datasheets/ManualsPrintable datasheet for anti-SNCB (ARP33883_P050) antibody
Gene SymbolSNCB
Official Gene Full Namesynuclein, beta
Alias SymbolsSNCB, Beta-synuclein
NCBI Gene Id6620
Protein NameBeta-synuclein
Description of TargetThe protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene.
Swissprot IdQ16143
Protein Accession #XP_006714979
Protein Size (# AA)134
Molecular Weight14kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express SNCB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express SNCB.
Protein InteractionsPLK1; PLK3; Tubb3; Tuba1a; LNX1; HSPA1A; CENPT; SEPT4; GRK5; SNCA; APP; ADRBK1; GRK1; GRK6;
Write Your Own Review
You're reviewing:SNCB Antibody - C-terminal region (ARP33883_P050)
Your Rating
Aviva Tips and Tricks
Aviva Live Chat
Aviva Validation Data
Aviva HIS tag Deal