Search Antibody, Protein, and ELISA Kit Solutions

SNCB Antibody - C-terminal region (ARP33883_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33883_P050-FITC Conjugated

ARP33883_P050-HRP Conjugated

ARP33883_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
SNCB
Official Gene Full Name:
synuclein, beta
NCBI Gene Id:
6620
Protein Name:
Beta-synuclein
Swissprot Id:
Q16143
Protein Accession #:
XP_006714979
Alias Symbols:
SNCB, Beta-synuclein
Description of Target:
The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
134
Molecular Weight:
14kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNCB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNCB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNCB
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-SNCB (ARP33883_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PLK1; PLK3; Tubb3; Tuba1a; LNX1; HSPA1A; CENPT; SEPT4; GRK5; SNCA; APP; ADRBK1; GRK1; GRK6;
Blocking Peptide:
For anti-SNCB (ARP33883_P050) antibody is Catalog # AAP33883
Datasheets/Manuals:
Printable datasheet for anti-SNCB (ARP33883_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...