SYUB Antibody - C-terminal region : HRP (ARP33883_P050-HRP)

Catalog No: ARP33883_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SYUB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SYUB (ARP33883_P050-HRP) antibody is Catalog # AAP33883

Target Info

• Gene Symbol: SYUB
• Gene Full Name: synuclein, beta
• Alias Symbols: SNCB,
• NCBI Gene Id: 6620
• Protein Name: Beta-synuclein
• Description of Target: The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene.
• Uniprot ID: Q16143
• Protein Accession #: XP_006714979
• Protein Size (# AA): 134
• Molecular Weight: 14kDa
• Protein Interactions: PLK1; PLK3; Tubb3; Tuba1a; LNX1; HSPA1A; CENPT; SEPT4; GRK5; SNCA; APP; ADRBK1; GRK1; GRK6;