| Product Number |
ARP33883_P050 |
| Product Page |
www.avivasysbio.com/sncb-antibody-c-terminal-region-arp33883-p050.html |
| Name |
SNCB Antibody - C-terminal region (ARP33883_P050) |
| Protein Size (# AA) |
134 amino acids |
| Molecular Weight |
14kDa |
| NCBI Gene Id |
6620 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
synuclein, beta |
| Alias Symbols |
SNCB, Beta-synuclein |
| Peptide Sequence |
Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is highly homologous to alpha-synuclein. These proteins are abundantly expressed in the brain and putatively inhibit phospholipase D2 selectively. The encoded protein, which may play a role in neuronal plasticity, is abundant in neurofibrillary lesions of patients with Alzheimer disease. This protein has been shown to be highly expressed in the substantia nigra of the brain, a region of neuronal degeneration in patients with Parkinson disease; however, no direct relation to Parkinson disease has been established. Two transcript variants encoding the same protein have been found for this gene. |
| Protein Interactions |
PLK1; PLK3; Tubb3; Tuba1a; LNX1; HSPA1A; CENPT; SEPT4; GRK5; SNCA; APP; ADRBK1; GRK1; GRK6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNCB (ARP33883_P050) antibody |
| Blocking Peptide |
For anti-SNCB (ARP33883_P050) antibody is Catalog # AAP33883 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNCB |
| Uniprot ID |
Q16143 |
| Protein Name |
Beta-synuclein |
| Protein Accession # |
XP_006714979 |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNCB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: SYUB
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
