SLC16A1 Antibody - middle region (ARP43841_T100)

Catalog No: ARP43841_T100

WB Suggested Anti-SLC16A1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC16A1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-SLC16A1 (ARP43841_T100) antibody is Catalog # AAP43841 (Previous Catalog # AAPS14302)
• Reference: Borthakur,A., Am. J. Physiol. Gastrointest. Liver Physiol. 290 (1), G30-G35

Target Info

• Gene Symbol: SLC16A1
• Gene Full Name: Solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
• Alias Symbols: MCT, HHF7, MCT1, MCT1D
• NCBI Gene Id: 6566
• Protein Name: Monocarboxylate transporter 1
• Description of Target: SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT.
• Uniprot ID: P53985
• Protein Accession #: NP_003042
• Nucleotide Accession #: NM_003051
• Protein Size (# AA): 500
• Molecular Weight: 54kDa
• Protein Interactions: UBC; LGR4; BSG; CYSTM1; CUL2; CUL3; MME; SERINC3; DEGS1; AP1S1;