Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP43842_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43842_P050-FITC Conjugated

ARP43842_P050-HRP Conjugated

ARP43842_P050-Biotin Conjugated

SLC16A1 Antibody - middle region (ARP43842_P050)

Catalog#: ARP43842_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-14916 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC16A1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-SLC16A1 (ARP43842_P050)
Peptide Sequence Synthetic peptide located within the following region: EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-SLC16A1 (ARP43842_P050) antibody is Catalog # AAP43842 (Previous Catalog # AAPS14303)
Datasheets/Manuals Printable datasheet for anti-SLC16A1 (ARP43842_P050) antibody
Sample Type Confirmation

SLC16A1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

Target Reference Metz,L., (2008) J. Appl. Physiol. 104 (3), 633-638
Gene Symbol SLC16A1
Official Gene Full Name Solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Alias Symbols FLJ36745, MCT, MCT1, MGC44475, HHF7
NCBI Gene Id 6566
Protein Name Monocarboxylate transporter 1
Description of Target SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the actio
Swissprot Id P53985
Protein Accession # NP_003042
Nucleotide Accession # NM_003051
Protein Size (# AA) 500
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC16A1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC16A1.
Protein Interactions UBC; LGR4; BSG; CYSTM1; CUL2; CUL3; MME; SERINC3; DEGS1; AP1S1;
  1. What is the species homology for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC16A1 Antibody - middle region (ARP43842_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    This target may also be called "FLJ36745, MCT, MCT1, MGC44475, HHF7" in publications.

  5. What is the shipping cost for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC16A1 Antibody - middle region (ARP43842_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SLC16A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC16A1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC16A1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC16A1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC16A1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC16A1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC16A1 Antibody - middle region (ARP43842_P050)
Your Rating
We found other products you might like!