Search Antibody, Protein, and ELISA Kit Solutions

SLC16A1 antibody - middle region (ARP43842_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43842_P050-FITC Conjugated

ARP43842_P050-HRP Conjugated

ARP43842_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Protein Name:
Monocarboxylate transporter 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ36745, MCT, MCT1, MGC44475, HHF7
Replacement Item:
This antibody may replace item sc-14916 from Santa Cruz Biotechnology.
Description of Target:
SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the actio
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC16A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC16A1.
The immunogen is a synthetic peptide directed towards the middle region of human SLC16A1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-SLC16A1 (ARP43842_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SLC16A1 (ARP43842_P050) antibody is Catalog # AAP43842 (Previous Catalog # AAPS14303)
Printable datasheet for anti-SLC16A1 (ARP43842_P050) antibody
Sample Type Confirmation:

SLC16A1 is strongly supported by BioGPS gene expression data to be expressed in HT1080

Target Reference:
Metz,L., (2008) J. Appl. Physiol. 104 (3), 633-638

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...