Search Antibody, Protein, and ELISA Kit Solutions

SEMA4F Antibody - N-terminal region (ARP46421_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46421_P050-FITC Conjugated

ARP46421_P050-HRP Conjugated

ARP46421_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-135264 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-SEMA4F (ARP46421_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SEMA4F (ARP46421_P050) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Printable datasheet for anti-SEMA4F (ARP46421_P050) antibody
Gene Symbol:
Official Gene Full Name:
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Alias Symbols:
NCBI Gene Id:
Protein Name:
Description of Target:
SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SEMA4F.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SEMA4F.
Protein Interactions:

Product Reviews

Average Rating:
2 reviews
5 star
4 star
3 star
2 star
1 star
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in A431 cells using Western Blot
Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species + Tissue/Cell type: A431 cells
How many ug's of tissue/cell lysate run on the gel:
1. A431 cell lysate + control siRNA
2. A431 cell lysate + SEMA4F siRNA
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000


How do Aviva's reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?


Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

Have you used another antibody which has worked in your application?


If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?


How did you store the antibody after re-suspension?

4 degree C.

Western Blot Sample Description (please include 1) species type, and 2) cell/tissue type, and 3) how much protein loaded for each lane of your gel):

Human cell lines A431, load ab 500,000 cells per lane.

How many different experimental trials were conducted using the antibody sample?


How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours.

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours.

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.
Show more comments (-2) Hide comments
02/01/2017 16:23
  • Overall Experience:
  • Quality:
Product Review: SEMA4F antibody - N-terminal region (ARP46421_P050) in human pancreatic carcinoma cell line MIA PaCa-2 cells using Western Blot
Product Page for SEMA4F antibody - N-terminal region (ARP46421_P050)

Researcher: Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Application: Western blotting
Species + Tissue/Cell type: MIA-PACA2 cells
How many ug's of tissue/cell lysate run on the gel:
1. Untransfected MIA-PACA2 cell lysate
2. Untransfected MIA-PACA2 cell lysate
3. Untransfected MIA-PACA2 cell lysate
4. hSEMA4F transfected MIA-PACA2 cell lysate
5. Untransfected MIA-PACA2 cell lysate
6. hSEMA4F transfected MIA-PACA2 cell lysate
Primary antibody dilution: 1:600
Secondary antibody: Donkey Anti-rabbit HRP
Secondary antibody dilution: 1:3000


How do Aviva's reagents play a role in your experimental goals?

React with overexpression system and native (not sure).

How would you rate this antibody on a scale from 1-5 (5=best) and why?


Would you use this antibody in future experiments?

WB for overexpression system and WB for cell express high level of sema4F.

If the antibody works, do you plan to use it in future experiments or to publish your data? Why or why not?

Yes, if it works.

How did you store the antibody after re-suspension?

4 degree

How many different experimental trials were conducted using the antibody sample?


How was this sample prepared?

Transfection control siRNA or sema4F siRNA to cells, after 48 hours lysate the cell for WB. 6well plate full of cells, add 200 ul RIPA buffer per well, 4 degree 20 min rotation then centrifuge 10min at maxi rmp. Pick the supernatant and boiled 5min with lamili.

Primary antibody dilution and incubation time:

1:600, 4 degree overnight.

Secondary antibody used and dilution and incubation time:

1:3000, RT 2 hours

What controls were used in your experiment (positive/negative)?

Control siRNA knockdown.

Please include your detailed WB Procedure/Protocol here:

Samples are load on 8% SDS PAGE gel, 40ul per well.

150v for 1.5 hours

Transfer the gel to membrane (10%methal) at 400mA ,2hours.

Block with 5% milk in TBST 1hour at RT.

Incubate with antibody diluted in block buffer at 4 degree overnight.

Wash 3 time with TBST , 15min each.

2nd antibody dilute in block buffer at RT for 2 hours.

Wash 3 times with TBST; 15 min each.

Develop with ECL in dark room.
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...