SEMA4F Antibody - N-terminal region (ARP46421_P050)

Data Sheet
 
Product Number ARP46421_P050
Product Page www.avivasysbio.com/sema4f-antibody-n-terminal-region-arp46421-p050.html
Name SEMA4F Antibody - N-terminal region (ARP46421_P050)
Gene Symbol SEMA4F
Alias Symbols SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
Protein Size (# AA) 615 amino acids
Molecular Weight 67kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 10505
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Peptide Sequence Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Description of Target SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Protein Interactions DLG4; NRP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SEMA4F (ARP46421_P050) antibody
Blocking Peptide For anti-SEMA4F (ARP46421_P050) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
Complete computational species homology data Anti-SEMA4F (ARP46421_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SEMA4F.
Swissprot Id O95754-2
Protein Name Semaphorin-4F
Protein Accession # AAH18361
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SEMA4F.
Nucleotide Accession # NM_004263
Replacement Item This antibody may replace item sc-135264 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
human A431
human cell line A431
Primary antibody dilution and incubation time:1:600, 4 degree overnightSecondary antibody used and dilution and incubation time: 1:3000, RT 2 hours
Image 2
Human MIA-PACA2
Lanes:
1. Untransfected MIA-PACA2 cell lysate
2. Untransfected MIA-PACA2 cell lysate
3. Untransfected MIA-PACA2 cell lysate
4. hSEMA4F transfected MIA-PACA2 cell lysate
5. Untransfected MIA-PACA2 cell lysate
6. hSEMA4F transfected MIA-PACA2 cell lysate
Primary Antibody Dilution:
1:600
Secondary Antibody:
Donkey Anti-rabbit HRP
Secondary Antibody Dilution:
1:3000
Gene Name:
SEMA4F
Submitted by:
Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Image 3
Human A431
Lanes:
1. A431 cell lysate + control siRNA 2. A431 cell lysate + SEMA4F siRNA
Primary Antibody Dilution:
1:600
Secondary Antibody:
Donkey Anti-rabbit HRP
Secondary Antibody Dilution:
1:3000
Gene Name:
SEMA4F
Submitted by:
Dr. Tianliang Sun, Max Planck Institute for Heart and Lung Research
Image 4
Transfected 293T
WB Suggested Anti-SEMA4F Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com