Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46421_P050 Unconjugated

ARP46421_P050-FITC Conjugated

ARP46421_P050-Biotin Conjugated

SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)

Catalog#: ARP46421_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-135264 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human SEMA4F
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-SEMA4F (ARP46421_P050)
Peptide Sequence Synthetic peptide located within the following region: PFSGERPRRIDWMVPEAHRQNCRKKGKKEGDLGGRKTLQQRWTTFLKADL
Concentration 0.5 mg/ml
Blocking Peptide For anti-SEMA4F (ARP46421_P050-HRP) antibody is Catalog # AAP46421 (Previous Catalog # AAPS18111)
Datasheets/Manuals Printable datasheet for anti-SEMA4F (ARP46421_P050-HRP) antibody
Gene Symbol SEMA4F
Official Gene Full Name Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F
Alias Symbols SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M
NCBI Gene Id 10505
Protein Name Semaphorin-4F
Description of Target SEMA4F has growth cone collapse activity against retinal ganglion-cell axons.
Swissprot Id O95754-2
Protein Accession # AAH18361
Nucleotide Accession # NM_004263
Protein Size (# AA) 615
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SEMA4F.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SEMA4F.
Protein Interactions DLG4; NRP2;
  1. What is the species homology for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    This target may also be called "SEMAM, SEMAW, M-SEMA, PRO2353, m-Sema-M" in publications.

  5. What is the shipping cost for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "67kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "SEMA4F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SEMA4F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SEMA4F"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SEMA4F"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SEMA4F"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SEMA4F"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SEMA4F Antibody - N-terminal region : HRP (ARP46421_P050-HRP)
Your Rating
We found other products you might like!