Search Antibody, Protein, and ELISA Kit Solutions

SDHD Antibody - N-terminal region (ARP73720_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73720_P050-FITC Conjugated

ARP73720_P050-HRP Conjugated

ARP73720_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Protein Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-293275 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SDHD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SDHD.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-SDHD (ARP73720_P050) antibody is Catalog # AAP73720
Printable datasheet for anti-SDHD (ARP73720_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...