SDHD Antibody - N-terminal region (ARP73720_P050)

• Product Number: ARP73720_P050
• Name: SDHD Antibody - N-terminal region (ARP73720_P050)
• Protein Size (# AA): 159 amino acids
• Molecular Weight: 17kDa
• NCBI Gene Id: 6392
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Alias Symbols: PGL, CBT1, CWS3, PGL1, QPs3, SDH4, cybS, CII-4, MC2DN3
• Peptide Sequence: Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SDHD (ARP73720_P050) antibody is Catalog # AAP73720
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD
• Uniprot ID: O14521
• Protein Accession #: NP_002993
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: SDHD
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: SDHD
  Sample Type: HepG2 Whole Cell lysates
  Antibody Dilution: 1.0ug/ml