Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SDHD Antibody - N-terminal region : FITC (ARP73720_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73720_P050 Unconjugated

ARP73720_P050-HRP Conjugated

ARP73720_P050-Biotin Conjugated

Gene Symbol:
SDHD
NCBI Gene Id:
6392
Swissprot Id:
O14521
Protein Accession #:
NP_002993
Alias Symbols:
SDHD, SDH4,
Replacement Item:
This antibody may replace item sc-293275 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of complex II of the respiratory chain, which is responsible for the oxidation of succinate. The encoded protein is one of two integral membrane proteins anchoring the complex to the matrix side of the mitochondrial inner membrane. Mutations in this gene are associated with the formation of tumors, including hereditary paraganglioma. Transmission of disease occurs almost exclusively through the paternal allele, suggesting that this locus may be maternally imprinted. There are pseudogenes for this gene on chromosomes 1, 2, 3, 7, and 18. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
159
Molecular Weight:
17kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SDHD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SDHD.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHD
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: AHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Blocking Peptide:
For anti-SDHD (ARP73720_P050-FITC) antibody is Catalog # AAP73720
Datasheets/Manuals:
Printable datasheet for anti-SDHD (ARP73720_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...