Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

RPE antibody - N-terminal region (ARP56726_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP56726_P050-FITC Conjugated

ARP56726_P050-HRP Conjugated

ARP56726_P050-Biotin Conjugated

Gene Symbol:
RPE
NCBI Gene Id:
6120
Official Gene Full Name:
Ribulose-5-phosphate-3-epimerase
Protein Name:
Putative uncharacterized protein RPE EMBL AAX93087.1
Swissprot Id:
Q53TV9
Protein Accession #:
NP_008847
Nucleotide Accession #:
NM_006916
Alias Symbols:
MGC2636, RPE2-1
Replacement Item:
This antibody may replace item sc-162124 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
178
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RPE.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RPE.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human RPE
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Complete computational species homology data:
Anti-RPE (ARP56726_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPE; UBC; MRI1; EXOSC10;
Blocking Peptide:
For anti-RPE (ARP56726_P050) antibody is Catalog # AAP56726 (Previous Catalog # AAPP41901)
Datasheets/Manuals:
Printable datasheet for anti-RPE (ARP56726_P050) antibody
Sample Type Confirmation:

RPE is strongly supported by BioGPS gene expression data to be expressed in ACHN

Tell us what you think about this item!

Write A Review
    Please, wait...