Product Number |
ARP56726_P050 |
Product Page |
www.avivasysbio.com/rpe-antibody-n-terminal-region-arp56726-p050.html |
Name |
RPE Antibody - N-terminal region (ARP56726_P050) |
Protein Size (# AA) |
178 amino acids |
Molecular Weight |
19kDa |
NCBI Gene Id |
6120 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ribulose-5-phosphate-3-epimerase |
Alias Symbols |
RPE2-1 |
Peptide Sequence |
Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Protein Interactions |
RPE; UBC; MRI1; EXOSC10; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RPE (ARP56726_P050) antibody |
Blocking Peptide |
For anti-RPE (ARP56726_P050) antibody is Catalog # AAP56726 (Previous Catalog # AAPP41901) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RPE |
Uniprot ID |
Q53TV9 |
Protein Name |
Putative uncharacterized protein RPE EMBL AAX93087.1 |
Sample Type Confirmation |
RPE is strongly supported by BioGPS gene expression data to be expressed in ACHN |
Protein Accession # |
NP_008847 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006916 |
Tested Species Reactivity |
Human |
Gene Symbol |
RPE |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86% |
Image 1 | Human ACHN
| WB Suggested Anti-RPE Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: ACHN cell lysateRPE is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells |
|
Image 2 | Human Adult Liver
| Rabbit Anti-RPE Antibody
Catalog Number: ARP56726_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
Image 3 | Heart
| Rabbit Anti-RPE antibody Catalog Number: ARP56726 Formalin Fixed Paraffin Embedded Tissue: Human Adult Heart Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 2.0 sec
|
|