RPE Antibody - N-terminal region (ARP56726_P050)

Data Sheet
 
Product Number ARP56726_P050
Product Page www.avivasysbio.com/rpe-antibody-n-terminal-region-arp56726-p050.html
Name RPE Antibody - N-terminal region (ARP56726_P050)
Protein Size (# AA) 178 amino acids
Molecular Weight 19kDa
NCBI Gene Id 6120
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ribulose-5-phosphate-3-epimerase
Alias Symbols RPE2-1
Peptide Sequence Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions RPE; UBC; MRI1; EXOSC10;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RPE (ARP56726_P050) antibody
Blocking Peptide For anti-RPE (ARP56726_P050) antibody is Catalog # AAP56726 (Previous Catalog # AAPP41901)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RPE
Uniprot ID Q53TV9
Protein Name Putative uncharacterized protein RPE EMBL AAX93087.1
Sample Type Confirmation

RPE is strongly supported by BioGPS gene expression data to be expressed in ACHN

Protein Accession # NP_008847
Purification Affinity Purified
Nucleotide Accession # NM_006916
Tested Species Reactivity Human
Gene Symbol RPE
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Image 1
Human ACHN
WB Suggested Anti-RPE Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysateRPE is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells
Image 2
Human Adult Liver
Rabbit Anti-RPE Antibody
Catalog Number: ARP56726_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.
Image 3
Heart
Rabbit Anti-RPE antibody
Catalog Number: ARP56726
Formalin Fixed Paraffin Embedded Tissue: Human Adult Heart
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com